B3GALT5,B3GalT-V
  • B3GALT5,B3GalT-V

Anti-B3GALT5 Antibody 25ul

Ref: AN-HPA054684-25ul
Anti-B3GALT5

Información del producto

Polyclonal Antibody against Human B3GALT5, Gene description: UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5, Alternative Gene Names: B3GalT-V, B3T5, beta3Gal-T5, GLCT5, Validated applications: IHC, Uniprot ID: Q9Y2C3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name B3GALT5
Gene Description UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence YSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTW
Immunogen YSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B3GalT-V, B3T5, beta3Gal-T5, GLCT5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y2C3
HTS Code 3002150000
Gene ID 10317
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-B3GALT5 Antibody 25ul

Anti-B3GALT5 Antibody 25ul