PPP1R14A,CPI-17
  • PPP1R14A,CPI-17

Anti-PPP1R14A Antibody 25ul

Ref: AN-HPA054534-25ul
Anti-PPP1R14A

Información del producto

Polyclonal Antibody against Human PPP1R14A, Gene description: protein phosphatase 1, regulatory (inhibitor) subunit 14A, Alternative Gene Names: CPI-17, PPP1INL, Validated applications: ICC, Uniprot ID: Q96A00, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PPP1R14A
Gene Description protein phosphatase 1, regulatory (inhibitor) subunit 14A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLS
Immunogen GLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CPI-17, PPP1INL
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96A00
HTS Code 3002150000
Gene ID 94274
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PPP1R14A Antibody 25ul

Anti-PPP1R14A Antibody 25ul