IST1,KIAA0174
  • IST1,KIAA0174

Anti-IST1 Antibody 100ul

Ref: AN-HPA054532-100ul
Anti-IST1

Información del producto

Polyclonal Antibody against Human IST1, Gene description: increased sodium tolerance 1 homolog (yeast), Alternative Gene Names: KIAA0174, Validated applications: ICC, IHC, WB, Uniprot ID: P53990, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IST1
Gene Description increased sodium tolerance 1 homolog (yeast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence LGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLL
Immunogen LGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0174
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P53990
HTS Code 3002150000
Gene ID 9798
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IST1 Antibody 100ul

Anti-IST1 Antibody 100ul