EDA2R,EDA-A2R
  • EDA2R,EDA-A2R

Anti-EDA2R Antibody 25ul

Ref: AN-HPA054522-25ul
Anti-EDA2R

Información del producto

Polyclonal Antibody against Human EDA2R, Gene description: ectodysplasin A2 receptor, Alternative Gene Names: EDA-A2R, EDAA2R, TNFRSF27, XEDAR, Validated applications: ICC, Uniprot ID: Q9HAV5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EDA2R
Gene Description ectodysplasin A2 receptor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence CQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHKCQSCITCAVINRVQKVNCTATS
Immunogen CQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHKCQSCITCAVINRVQKVNCTATS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EDA-A2R, EDAA2R, TNFRSF27, XEDAR
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HAV5
HTS Code 3002150000
Gene ID 60401
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EDA2R Antibody 25ul

Anti-EDA2R Antibody 25ul