CIART,BC017397
  • CIART,BC017397

Anti-CIART Antibody 100ul

Ref: AN-HPA054349-100ul
Anti-CIART

Información del producto

Polyclonal Antibody against Human CIART, Gene description: circadian associated repressor of transcription, Alternative Gene Names: BC017397, C1orf51, Validated applications: ICC, Uniprot ID: Q8N365, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CIART
Gene Description circadian associated repressor of transcription
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SLGGGKHQLTKHFPSHHSDSAASSPASPMEKMDQTQLGHLALKPKQPWHLTQWPAMNLTWIHTTPICNPPLSSPGTISFSHGPLGTGTGI
Immunogen SLGGGKHQLTKHFPSHHSDSAASSPASPMEKMDQTQLGHLALKPKQPWHLTQWPAMNLTWIHTTPICNPPLSSPGTISFSHGPLGTGTGI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BC017397, C1orf51
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N365
HTS Code 3002150000
Gene ID 148523
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CIART Antibody 100ul

Anti-CIART Antibody 100ul