TRIM45,FLJ13181
  • TRIM45,FLJ13181

Anti-TRIM45 Antibody 25ul

Ref: AN-HPA054308-25ul
Anti-TRIM45

Información del producto

Polyclonal Antibody against Human TRIM45, Gene description: tripartite motif containing 45, Alternative Gene Names: FLJ13181, RNF99, Validated applications: ICC, Uniprot ID: Q9H8W5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TRIM45
Gene Description tripartite motif containing 45
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRSLQSQIGILCPVCDAQVDLPMGGVKALTIDHLAVNDVMLE
Immunogen LLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRSLQSQIGILCPVCDAQVDLPMGGVKALTIDHLAVNDVMLE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ13181, RNF99
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H8W5
HTS Code 3002150000
Gene ID 80263
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TRIM45 Antibody 25ul

Anti-TRIM45 Antibody 25ul