HP1BP3,HP1-BP74
  • HP1BP3,HP1-BP74

Anti-HP1BP3 Antibody 25ul

Ref: AN-HPA054295-25ul
Anti-HP1BP3

Información del producto

Polyclonal Antibody against Human HP1BP3, Gene description: heterochromatin protein 1, binding protein 3, Alternative Gene Names: HP1-BP74, Validated applications: ICC, Uniprot ID: Q5SSJ5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HP1BP3
Gene Description heterochromatin protein 1, binding protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence ITGKGASGTFQLKKSGEKPLLGGSLMEYAILSAIAAMNEPKTCSTTALKKYVLENHPGTNSNYQMHLLKKTLQKCEKNGWME
Immunogen ITGKGASGTFQLKKSGEKPLLGGSLMEYAILSAIAAMNEPKTCSTTALKKYVLENHPGTNSNYQMHLLKKTLQKCEKNGWME
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HP1-BP74
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5SSJ5
HTS Code 3002150000
Gene ID 50809
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HP1BP3 Antibody 25ul

Anti-HP1BP3 Antibody 25ul