RPS6KA2,HU-2,RSK
  • RPS6KA2,HU-2,RSK

Anti-RPS6KA2 Antibody 100ul

Ref: AN-HPA054237-100ul
Anti-RPS6KA2

Información del producto

Polyclonal Antibody against Human RPS6KA2, Gene description: ribosomal protein S6 kinase, 90kDa, polypeptide 2, Alternative Gene Names: HU-2, RSK, RSK3, Validated applications: IHC, Uniprot ID: Q15349, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RPS6KA2
Gene Description ribosomal protein S6 kinase, 90kDa, polypeptide 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VASSLIQEPSQQDLHKVPVHPIVQQLHGNNIHFTDGYEIK
Immunogen VASSLIQEPSQQDLHKVPVHPIVQQLHGNNIHFTDGYEIK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HU-2, RSK, RSK3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15349
HTS Code 3002150000
Gene ID 6196
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RPS6KA2 Antibody 100ul

Anti-RPS6KA2 Antibody 100ul