PLA2G4A,cPLA2-alpha
  • PLA2G4A,cPLA2-alpha

Anti-PLA2G4A Antibody 25ul

Ref: AN-HPA054206-25ul
Anti-PLA2G4A

Información del producto

Polyclonal Antibody against Human PLA2G4A, Gene description: phospholipase A2, group IVA (cytosolic, calcium-dependent), Alternative Gene Names: cPLA2-alpha, PLA2G4, Validated applications: ICC, IHC, Uniprot ID: P47712, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PLA2G4A
Gene Description phospholipase A2, group IVA (cytosolic, calcium-dependent)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence PRETEEEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQNPSRCSVSLSNVEARRFFNKEFLSK
Immunogen PRETEEEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQNPSRCSVSLSNVEARRFFNKEFLSK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names cPLA2-alpha, PLA2G4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P47712
HTS Code 3002150000
Gene ID 5321
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PLA2G4A Antibody 25ul

Anti-PLA2G4A Antibody 25ul