VTCN1,B7-H4,B7H4
  • VTCN1,B7-H4,B7H4

Anti-VTCN1 Antibody 100ul

Ref: AN-HPA054200-100ul
Anti-VTCN1

Información del producto

Polyclonal Antibody against Human VTCN1, Gene description: V-set domain containing T cell activation inhibitor 1, Alternative Gene Names: B7-H4, B7H4, B7S1, B7X, FLJ22418, Validated applications: ICC, IHC, Uniprot ID: Q7Z7D3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name VTCN1
Gene Description V-set domain containing T cell activation inhibitor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRL
Immunogen ISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B7-H4, B7H4, B7S1, B7X, FLJ22418
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z7D3
HTS Code 3002150000
Gene ID 79679
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-VTCN1 Antibody 100ul

Anti-VTCN1 Antibody 100ul