RAB35,H-ray
  • RAB35,H-ray

Anti-RAB35 Antibody 100ul

Ref: AN-HPA054146-100ul
Anti-RAB35

Información del producto

Polyclonal Antibody against Human RAB35, Gene description: RAB35, member RAS oncogene family, Alternative Gene Names: H-ray, Validated applications: IHC, Uniprot ID: Q15286, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RAB35
Gene Description RAB35, member RAS oncogene family
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRC
Immunogen AKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names H-ray
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15286
HTS Code 3002150000
Gene ID 11021
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RAB35 Antibody 100ul

Anti-RAB35 Antibody 100ul