VTI1A,MVti1
  • VTI1A,MVti1

Anti-VTI1A Antibody 100ul

Ref: AN-HPA054108-100ul
Anti-VTI1A

Información del producto

Polyclonal Antibody against Human VTI1A, Gene description: vesicle transport through interaction with t-SNAREs 1A, Alternative Gene Names: MVti1, Vti1-rp2, Vti1a, Validated applications: ICC, IHC, WB, Uniprot ID: Q96AJ9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name VTI1A
Gene Description vesicle transport through interaction with t-SNAREs 1A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence SSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRGCSVKKQCNLSLAPK
Immunogen SSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRGCSVKKQCNLSLAPK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MVti1, Vti1-rp2, Vti1a
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96AJ9
HTS Code 3002150000
Gene ID 143187
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-VTI1A Antibody 100ul

Anti-VTI1A Antibody 100ul