NR1D2,BD73,EAR-1r
  • NR1D2,BD73,EAR-1r

Anti-NR1D2 Antibody 100ul

Ref: AN-HPA053868-100ul
Anti-NR1D2

Información del producto

Polyclonal Antibody against Human NR1D2, Gene description: nuclear receptor subfamily 1, group D, member 2, Alternative Gene Names: BD73, EAR-1r, Hs.37288, HZF2, RVR, Validated applications: ICC, WB, Uniprot ID: Q14995, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NR1D2
Gene Description nuclear receptor subfamily 1, group D, member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence SHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPLSKSP
Immunogen SHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPLSKSP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BD73, EAR-1r, Hs.37288, HZF2, RVR
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14995
HTS Code 3002150000
Gene ID 9975
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NR1D2 Antibody 100ul

Anti-NR1D2 Antibody 100ul