CTU1,ATPBD3
  • CTU1,ATPBD3

Anti-CTU1 Antibody 25ul

Ref: AN-HPA053797-25ul
Anti-CTU1

Información del producto

Polyclonal Antibody against Human CTU1, Gene description: cytosolic thiouridylase subunit 1, Alternative Gene Names: ATPBD3, MGC17332, NCS6, Validated applications: IHC, Uniprot ID: Q7Z7A3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CTU1
Gene Description cytosolic thiouridylase subunit 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYEDLFGGWTMDAVARSTAGSGRSRSCCTFCGVLR
Immunogen RLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYEDLFGGWTMDAVARSTAGSGRSRSCCTFCGVLR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ATPBD3, MGC17332, NCS6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z7A3
HTS Code 3002150000
Gene ID 90353
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CTU1 Antibody 25ul

Anti-CTU1 Antibody 25ul