SPAG1,CT140
  • SPAG1,CT140

Anti-SPAG1 Antibody 100ul

Ref: AN-HPA053682-100ul
Anti-SPAG1

Información del producto

Polyclonal Antibody against Human SPAG1, Gene description: sperm associated antigen 1, Alternative Gene Names: CT140, FLJ32920, HSD-3.8, SP75, TPIS, Validated applications: IHC, Uniprot ID: Q07617, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SPAG1
Gene Description sperm associated antigen 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KKTPRDYAEWDKFDVEKECLKIDEDYKEKTVIDKSHLSKIETRIDTAGLTEKEKDFLATREKEKGNEAFNSGDYEEAVMYYT
Immunogen KKTPRDYAEWDKFDVEKECLKIDEDYKEKTVIDKSHLSKIETRIDTAGLTEKEKDFLATREKEKGNEAFNSGDYEEAVMYYT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT140, FLJ32920, HSD-3.8, SP75, TPIS
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q07617
HTS Code 3002150000
Gene ID 6674
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SPAG1 Antibody 100ul

Anti-SPAG1 Antibody 100ul