ENPP2,ATX,PD-IALPHA
  • ENPP2,ATX,PD-IALPHA

Anti-ENPP2 Antibody 25ul

Ref: AN-HPA053652-25ul
Anti-ENPP2

Información del producto

Polyclonal Antibody against Human ENPP2, Gene description: ectonucleotide pyrophosphatase/phosphodiesterase 2, Alternative Gene Names: ATX, PD-IALPHA, PDNP2, Validated applications: ICC, Uniprot ID: Q13822, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ENPP2
Gene Description ectonucleotide pyrophosphatase/phosphodiesterase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence TNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLT
Immunogen TNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ATX, PD-IALPHA, PDNP2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13822
HTS Code 3002150000
Gene ID 5168
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ENPP2 Antibody 25ul

Anti-ENPP2 Antibody 25ul