TOGARAM1,crescerin
  • TOGARAM1,crescerin

Anti-TOGARAM1 Antibody 100ul

Ref: AN-HPA053559-100ul
Anti-TOGARAM1

Información del producto

Polyclonal Antibody against Human TOGARAM1, Gene description: TOG array regulator of axonemal microtubules 1, Alternative Gene Names: crescerin, Crescerin-1, FAM179B, KIAA0423, Validated applications: IHC, Uniprot ID: Q9Y4F4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TOGARAM1
Gene Description TOG array regulator of axonemal microtubules 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LLLEHLKHKHSRVREEVVNICICSLLTYPSEDFDLPKLSFDLAPALVDSKRRVRQAALEAFAVLASSMGSGKTSILFKAVDTVELQDNGDGVMNAVQ
Immunogen LLLEHLKHKHSRVREEVVNICICSLLTYPSEDFDLPKLSFDLAPALVDSKRRVRQAALEAFAVLASSMGSGKTSILFKAVDTVELQDNGDGVMNAVQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names crescerin, Crescerin-1, FAM179B, KIAA0423
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y4F4
HTS Code 3002150000
Gene ID 23116
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TOGARAM1 Antibody 100ul

Anti-TOGARAM1 Antibody 100ul