TEX30,C13orf27
  • TEX30,C13orf27

Anti-TEX30 Antibody 25ul

Ref: AN-HPA053545-25ul
Anti-TEX30

Información del producto

Polyclonal Antibody against Human TEX30, Gene description: testis expressed 30, Alternative Gene Names: C13orf27, Validated applications: IHC, WB, Uniprot ID: Q5JUR7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TEX30
Gene Description testis expressed 30
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence LGGRSMGSRAAASVMCHIEPDDGDDFVRGLICISYPLHHPKQQHKLRDEDLFRLKEPVLFVSGSADEMCEKNLLEKVAQKMQAP
Immunogen LGGRSMGSRAAASVMCHIEPDDGDDFVRGLICISYPLHHPKQQHKLRDEDLFRLKEPVLFVSGSADEMCEKNLLEKVAQKMQAP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C13orf27
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5JUR7
HTS Code 3002150000
Gene ID 93081
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TEX30 Antibody 25ul

Anti-TEX30 Antibody 25ul