MAVS,Cardif,IPS-1
  • MAVS,Cardif,IPS-1

Anti-MAVS Antibody 100ul

Ref: AN-HPA053524-100ul
Anti-MAVS

Información del producto

Polyclonal Antibody against Human MAVS, Gene description: mitochondrial antiviral signaling protein, Alternative Gene Names: Cardif, IPS-1, KIAA1271, VISA, Validated applications: ICC, IHC, Uniprot ID: Q7Z434, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MAVS
Gene Description mitochondrial antiviral signaling protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence GSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRK
Immunogen GSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Cardif, IPS-1, KIAA1271, VISA
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z434
HTS Code 3002150000
Gene ID 57506
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MAVS Antibody 100ul

Anti-MAVS Antibody 100ul