SIGLEC1,CD169
  • SIGLEC1,CD169

Anti-SIGLEC1 Antibody 100ul

Ref: AN-HPA053457-100ul
Anti-SIGLEC1

Información del producto

Polyclonal Antibody against Human SIGLEC1, Gene description: sialic acid binding Ig-like lectin 1, sialoadhesin, Alternative Gene Names: CD169, dJ1009E24.1, FLJ00051, FLJ00055, FLJ00073, FLJ32150, sialoadhesin, SIGLEC-1, SN, Validated applications: IHC, Uniprot ID: Q9BZZ2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SIGLEC1
Gene Description sialic acid binding Ig-like lectin 1, sialoadhesin
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CTAQNLLGSISTIGRLQVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPVPTLAFTHVARAQAGMYH
Immunogen CTAQNLLGSISTIGRLQVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPVPTLAFTHVARAQAGMYH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD169, dJ1009E24.1, FLJ00051, FLJ00055, FLJ00073, FLJ32150, sialoadhesin, SIGLEC-1, SN
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BZZ2
HTS Code 3002150000
Gene ID 6614
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SIGLEC1 Antibody 100ul

Anti-SIGLEC1 Antibody 100ul