TAS1R3,T1R3
  • TAS1R3,T1R3

Anti-TAS1R3 Antibody 25ul

Ref: AN-HPA053439-25ul
Anti-TAS1R3

Información del producto

Polyclonal Antibody against Human TAS1R3, Gene description: taste receptor, type 1, member 3, Alternative Gene Names: T1R3, Validated applications: IHC, Uniprot ID: Q7RTX0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TAS1R3
Gene Description taste receptor, type 1, member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence WLTSDLVMGLPGMAQMGTVLGFLQRGAQLHEFPQYVKTHLALATDPAFCSALGEREQGLEEDVVGQRCPQCDCITLQNVSAGLNHHQTFSVYAA
Immunogen WLTSDLVMGLPGMAQMGTVLGFLQRGAQLHEFPQYVKTHLALATDPAFCSALGEREQGLEEDVVGQRCPQCDCITLQNVSAGLNHHQTFSVYAA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names T1R3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7RTX0
HTS Code 3002150000
Gene ID 83756
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TAS1R3 Antibody 25ul

Anti-TAS1R3 Antibody 25ul