TRIM27,RFP,RNF76
  • TRIM27,RFP,RNF76

Anti-TRIM27 Antibody 25ul

Ref: AN-HPA053408-25ul
Anti-TRIM27

Información del producto

Polyclonal Antibody against Human TRIM27, Gene description: tripartite motif containing 27, Alternative Gene Names: RFP, RNF76, Validated applications: ICC, WB, Uniprot ID: P14373, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TRIM27
Gene Description tripartite motif containing 27
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence DIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQSDMEKIQELREAQLYSVDV
Immunogen DIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQSDMEKIQELREAQLYSVDV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names RFP, RNF76
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P14373
HTS Code 3002150000
Gene ID 5987
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TRIM27 Antibody 25ul

Anti-TRIM27 Antibody 25ul