AFF3,LAF4,MLLT2-like
  • AFF3,LAF4,MLLT2-like

Anti-AFF3 Antibody 100ul

Ref: AN-HPA053379-100ul
Anti-AFF3

Información del producto

Polyclonal Antibody against Human AFF3, Gene description: AF4/FMR2 family, member 3, Alternative Gene Names: LAF4, MLLT2-like, Validated applications: ICC, Uniprot ID: P51826, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name AFF3
Gene Description AF4/FMR2 family, member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence KSQGEKDSSSRLATSTSNTLSANHCNMNINSVAIPINKNEKMLRSPISPLSDASKHKYTSEDLTSSSRPNGNSLFTSASSSKKPKADSQLQPHGGDLTKAAHNNSENIPLHKSRPQTKPWSPGSNGHRDCKRQKLVFDDMP
Immunogen KSQGEKDSSSRLATSTSNTLSANHCNMNINSVAIPINKNEKMLRSPISPLSDASKHKYTSEDLTSSSRPNGNSLFTSASSSKKPKADSQLQPHGGDLTKAAHNNSENIPLHKSRPQTKPWSPGSNGHRDCKRQKLVFDDMP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LAF4, MLLT2-like
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51826
HTS Code 3002150000
Gene ID 3899
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-AFF3 Antibody 100ul

Anti-AFF3 Antibody 100ul