RFXANK,ANKRA1,BLS
  • RFXANK,ANKRA1,BLS

Anti-RFXANK Antibody 25ul

Ref: AN-HPA053330-25ul
Anti-RFXANK

Información del producto

Polyclonal Antibody against Human RFXANK, Gene description: regulatory factor X-associated ankyrin-containing protein, Alternative Gene Names: ANKRA1, BLS, F14150_1, MGC138628, RFX-B, Validated applications: ICC, Uniprot ID: O14593, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RFXANK
Gene Description regulatory factor X-associated ankyrin-containing protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence HQLAAQGELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETVRFLLEW
Immunogen HQLAAQGELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETVRFLLEW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ANKRA1, BLS, F14150_1, MGC138628, RFX-B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14593
HTS Code 3002150000
Gene ID 8625
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RFXANK Antibody 25ul

Anti-RFXANK Antibody 25ul