PSMB9,beta1i,LMP2
  • PSMB9,beta1i,LMP2

Anti-PSMB9 Antibody 100ul

Ref: AN-HPA053280-100ul
Anti-PSMB9

Información del producto

Polyclonal Antibody against Human PSMB9, Gene description: proteasome (prosome, macropain) subunit, beta type, 9, Alternative Gene Names: beta1i, LMP2, PSMB6i, RING12, Validated applications: IHC, WB, Uniprot ID: P28065, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PSMB9
Gene Description proteasome (prosome, macropain) subunit, beta type, 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence GVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGS
Immunogen GVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names beta1i, LMP2, PSMB6i, RING12
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P28065
HTS Code 3002150000
Gene ID 5698
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PSMB9 Antibody 100ul

Anti-PSMB9 Antibody 100ul