RIT1,MGC125864
  • RIT1,MGC125864

Anti-RIT1 Antibody 100ul

Ref: AN-HPA053249-100ul
Anti-RIT1

Información del producto

Polyclonal Antibody against Human RIT1, Gene description: Ras-like without CAAX 1, Alternative Gene Names: MGC125864, MGC125865, RIBB, RIT, ROC1, Validated applications: WB, Uniprot ID: Q92963, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RIT1
Gene Description Ras-like without CAAX 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB
Sequence AYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT
Immunogen AYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC125864, MGC125865, RIBB, RIT, ROC1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92963
HTS Code 3002150000
Gene ID 6016
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RIT1 Antibody 100ul

Anti-RIT1 Antibody 100ul