UBE2V1,CROC-1,CROC1
  • UBE2V1,CROC-1,CROC1

Anti-UBE2V1 Antibody 100ul

Ref: AN-HPA053186-100ul
Anti-UBE2V1

Información del producto

Polyclonal Antibody against Human UBE2V1, Gene description: ubiquitin-conjugating enzyme E2 variant 1, Alternative Gene Names: CROC-1, CROC1, UBE2V, UEV-1, UEV1A, Validated applications: ICC, Uniprot ID: Q13404, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UBE2V1
Gene Description ubiquitin-conjugating enzyme E2 variant 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG
Immunogen VLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CROC-1, CROC1, UBE2V, UEV-1, UEV1A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13404
HTS Code 3002150000
Gene ID 7335
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-UBE2V1 Antibody 100ul

Anti-UBE2V1 Antibody 100ul