TSPEAR,C21orf29
  • TSPEAR,C21orf29

Anti-TSPEAR Antibody 25ul

Ref: AN-HPA052995-25ul
Anti-TSPEAR

Información del producto

Polyclonal Antibody against Human TSPEAR, Gene description: thrombospondin-type laminin G domain and EAR repeats, Alternative Gene Names: C21orf29, DFNB98, MGC11251, TSP-EAR, Validated applications: IHC, Uniprot ID: Q8WU66, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TSPEAR
Gene Description thrombospondin-type laminin G domain and EAR repeats
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KGQEFSVIYKWSHRKLKFTPYQSIATHSARDWEAFEVDGEHFLAVANHREGDNHNIDSVIYKWNPATRLFEANQTIATSGAYDWEFFSVGPYSFLVVANTFNGTST
Immunogen KGQEFSVIYKWSHRKLKFTPYQSIATHSARDWEAFEVDGEHFLAVANHREGDNHNIDSVIYKWNPATRLFEANQTIATSGAYDWEFFSVGPYSFLVVANTFNGTST
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C21orf29, DFNB98, MGC11251, TSP-EAR
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WU66
HTS Code 3002150000
Gene ID 54084
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TSPEAR Antibody 25ul

Anti-TSPEAR Antibody 25ul