DENND5A,FLJ22354
  • DENND5A,FLJ22354

Anti-DENND5A Antibody 100ul

Ref: AN-HPA052923-100ul
Anti-DENND5A

Información del producto

Polyclonal Antibody against Human DENND5A, Gene description: DENN/MADD domain containing 5A, Alternative Gene Names: FLJ22354, FLJ33829, FLJ43455, KIAA1091, RAB6IP1, Validated applications: ICC, Uniprot ID: Q6IQ26, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DENND5A
Gene Description DENN/MADD domain containing 5A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MHNAEYDVLHAPPADDRDQSSMEDGEDTPVTKLQR
Immunogen MHNAEYDVLHAPPADDRDQSSMEDGEDTPVTKLQR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ22354, FLJ33829, FLJ43455, KIAA1091, RAB6IP1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6IQ26
HTS Code 3002150000
Gene ID 23258
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DENND5A Antibody 100ul

Anti-DENND5A Antibody 100ul