C4orf19,FLJ11017
  • C4orf19,FLJ11017

Anti-C4orf19 Antibody 25ul

Ref: AN-HPA052894-25ul
Anti-C4orf19

Información del producto

Polyclonal Antibody against Human C4orf19, Gene description: chromosome 4 open reading frame 19, Alternative Gene Names: FLJ11017, Validated applications: ICC, Uniprot ID: Q8IY42, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C4orf19
Gene Description chromosome 4 open reading frame 19
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence TQDDRGSWASTANTVPPTQPFLEGGGTRKQDCVLLASEGTQVMRNGDSRAPSEAESFALEVQDHVFQIPAPDYLQHWGPAGDNVDHNEKDCVFKNH
Immunogen TQDDRGSWASTANTVPPTQPFLEGGGTRKQDCVLLASEGTQVMRNGDSRAPSEAESFALEVQDHVFQIPAPDYLQHWGPAGDNVDHNEKDCVFKNH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ11017
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IY42
HTS Code 3002150000
Gene ID 55286
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C4orf19 Antibody 25ul

Anti-C4orf19 Antibody 25ul