FAT4,CDHF14,CDHR11
  • FAT4,CDHF14,CDHR11

Anti-FAT4 Antibody 25ul

Ref: AN-HPA052819-25ul
Anti-FAT4

Información del producto

Polyclonal Antibody against Human FAT4, Gene description: FAT atypical cadherin 4, Alternative Gene Names: CDHF14, CDHR11, FAT-J, Validated applications: ICC, IHC, Uniprot ID: Q6V0I7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FAT4
Gene Description FAT atypical cadherin 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence FDDPDNIPPYGDDMTVRKQPEGNPKPDIIERENPYLIYDETDIPHNSETIPSAPLASPEQEIEHYDIDNASSIAPSDADIIQHYKQFRSHT
Immunogen FDDPDNIPPYGDDMTVRKQPEGNPKPDIIERENPYLIYDETDIPHNSETIPSAPLASPEQEIEHYDIDNASSIAPSDADIIQHYKQFRSHT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CDHF14, CDHR11, FAT-J
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6V0I7
HTS Code 3002150000
Gene ID 79633
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FAT4 Antibody 25ul

Anti-FAT4 Antibody 25ul