DIP2A,C21orf106
  • DIP2A,C21orf106

Anti-DIP2A Antibody 100ul

Ref: AN-HPA052516-100ul
Anti-DIP2A

Información del producto

Polyclonal Antibody against Human DIP2A, Gene description: DIP2 disco-interacting protein 2 homolog A (Drosophila), Alternative Gene Names: C21orf106, Dip2, KIAA0184, Validated applications: ICC, IHC, Uniprot ID: Q14689, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DIP2A
Gene Description DIP2 disco-interacting protein 2 homolog A (Drosophila)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence RAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRS
Immunogen RAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C21orf106, Dip2, KIAA0184
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14689
HTS Code 3002150000
Gene ID 23181
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DIP2A Antibody 100ul

Anti-DIP2A Antibody 100ul