PSMB7,Z
  • PSMB7,Z

Anti-PSMB7 Antibody 25ul

Ref: AN-HPA052408-25ul
Anti-PSMB7

Información del producto

Polyclonal Antibody against Human PSMB7, Gene description: proteasome (prosome, macropain) subunit, beta type, 7, Alternative Gene Names: Z, Validated applications: IHC, Uniprot ID: Q99436, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PSMB7
Gene Description proteasome (prosome, macropain) subunit, beta type, 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEA
Immunogen RVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Z
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99436
HTS Code 3002150000
Gene ID 5695
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PSMB7 Antibody 25ul

Anti-PSMB7 Antibody 25ul