G6PC,G6PT,GSD1a
  • G6PC,G6PT,GSD1a

Anti-G6PC Antibody 25ul

Ref: AN-HPA052324-25ul
Anti-G6PC

Información del producto

Polyclonal Antibody against Human G6PC, Gene description: glucose-6-phosphatase, catalytic subunit, Alternative Gene Names: G6PT, GSD1a, Validated applications: IHC, Uniprot ID: P35575, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name G6PC
Gene Description glucose-6-phosphatase, catalytic subunit
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFIL
Immunogen MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFIL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names G6PT, GSD1a
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P35575
HTS Code 3002150000
Gene ID 2538
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-G6PC Antibody 25ul

Anti-G6PC Antibody 25ul