PLPPR3,FLJ11535
  • PLPPR3,FLJ11535

Anti-PLPPR3 Antibody 25ul

Ref: AN-HPA052293-25ul
Anti-PLPPR3

Información del producto

Polyclonal Antibody against Human PLPPR3, Gene description: phospholipid phosphatase related 3, Alternative Gene Names: FLJ11535, LPPR3, PRG-2, PRG2, Validated applications: IHC, Uniprot ID: Q6T4P5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PLPPR3
Gene Description phospholipid phosphatase related 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VYVSVSPAPHCPSQALLLTRGEPSLTPTPMPQMYFNSVISDTT
Immunogen VYVSVSPAPHCPSQALLLTRGEPSLTPTPMPQMYFNSVISDTT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ11535, LPPR3, PRG-2, PRG2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6T4P5
HTS Code 3002150000
Gene ID 79948
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PLPPR3 Antibody 25ul

Anti-PLPPR3 Antibody 25ul