ARPIN,C15orf38
  • ARPIN,C15orf38

Anti-ARPIN Antibody 100ul

Ref: AN-HPA052278-100ul
Anti-ARPIN

Información del producto

Polyclonal Antibody against Human ARPIN, Gene description: actin-related protein 2/3 complex inhibitor, Alternative Gene Names: C15orf38, MGC61550, Validated applications: IHC, Uniprot ID: Q7Z6K5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ARPIN
Gene Description actin-related protein 2/3 complex inhibitor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EVMELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAAEIREQGDGAEDEEWDD
Immunogen EVMELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAAEIREQGDGAEDEEWDD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C15orf38, MGC61550
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z6K5
HTS Code 3002150000
Gene ID 348110
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ARPIN Antibody 100ul

Anti-ARPIN Antibody 100ul