TIMM10B,FXC1,TIM10B
  • TIMM10B,FXC1,TIM10B

Anti-TIMM10B Antibody 100ul

Ref: AN-HPA052265-100ul
Anti-TIMM10B

Información del producto

Polyclonal Antibody against Human TIMM10B, Gene description: translocase of inner mitochondrial membrane 10 homolog B (yeast), Alternative Gene Names: FXC1, TIM10B, Tim9b, Validated applications: IHC, Uniprot ID: Q9Y5J6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TIMM10B
Gene Description translocase of inner mitochondrial membrane 10 homolog B (yeast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS
Immunogen QQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FXC1, TIM10B, Tim9b
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5J6
HTS Code 3002150000
Gene ID 26515
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TIMM10B Antibody 100ul

Anti-TIMM10B Antibody 100ul