ATP2C2,KIAA0703
  • ATP2C2,KIAA0703

Anti-ATP2C2 Antibody 100ul

Ref: AN-HPA052262-100ul
Anti-ATP2C2

Información del producto

Polyclonal Antibody against Human ATP2C2, Gene description: ATPase, Ca++ transporting, type 2C, member 2, Alternative Gene Names: KIAA0703, SPCA2, Validated applications: IHC, Uniprot ID: O75185, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ATP2C2
Gene Description ATPase, Ca++ transporting, type 2C, member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LEKDEEEALIDEQSELKAIEKEKKVTALPPKEACKCQKEDLARAFCVDLHTGLSEFSVTQRRLAHGWNEFVADNSEPVWKKYLDQ
Immunogen LEKDEEEALIDEQSELKAIEKEKKVTALPPKEACKCQKEDLARAFCVDLHTGLSEFSVTQRRLAHGWNEFVADNSEPVWKKYLDQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0703, SPCA2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75185
HTS Code 3002150000
Gene ID 9914
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ATP2C2 Antibody 100ul

Anti-ATP2C2 Antibody 100ul