WBSCR22,MERM1
  • WBSCR22,MERM1

Anti-WBSCR22 Antibody 100ul

Ref: AN-HPA052185-100ul
Anti-WBSCR22

Información del producto

Polyclonal Antibody against Human WBSCR22, Gene description: Williams Beuren syndrome chromosome region 22, Alternative Gene Names: MERM1, MGC19709, MGC2022, MGC5140, PP3381, WBMT, Validated applications: ICC, IHC, Uniprot ID: O43709, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name WBSCR22
Gene Description Williams Beuren syndrome chromosome region 22
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDE
Immunogen ELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MERM1, MGC19709, MGC2022, MGC5140, PP3381, WBMT
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43709
HTS Code 3002150000
Gene ID 114049
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-WBSCR22 Antibody 100ul

Anti-WBSCR22 Antibody 100ul