TMEM8B,C9orf127
  • TMEM8B,C9orf127

Anti-TMEM8B Antibody 100ul

Ref: AN-HPA052130-100ul
Anti-TMEM8B

Información del producto

Polyclonal Antibody against Human TMEM8B, Gene description: transmembrane protein 8B, Alternative Gene Names: C9orf127, NAG-5, NGX6, Validated applications: IHC, Uniprot ID: A6NDV4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TMEM8B
Gene Description transmembrane protein 8B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAVFAMRLLPVLD
Immunogen MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAVFAMRLLPVLD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C9orf127, NAG-5, NGX6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A6NDV4
HTS Code 3002150000
Gene ID 51754
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TMEM8B Antibody 100ul

Anti-TMEM8B Antibody 100ul