KIR3DX1,FLJ00060
  • KIR3DX1,FLJ00060

Anti-KIR3DX1 Antibody 100ul

Ref: AN-HPA052110-100ul
Anti-KIR3DX1

Información del producto

Polyclonal Antibody against Human KIR3DX1, Gene description: killer cell immunoglobulin-like receptor, three domains, X1, Alternative Gene Names: FLJ00060, LENG12, Validated applications: IHC, Uniprot ID: , Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KIR3DX1
Gene Description killer cell immunoglobulin-like receptor, three domains, X1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CVGIYKHASKWSAESNSLKIIVTGLFTKPSISAHPSSLVHAGARVSLRCHSELAFDEFILYKEGHIQHSQQLDQGME
Immunogen CVGIYKHASKWSAESNSLKIIVTGLFTKPSISAHPSSLVHAGARVSLRCHSELAFDEFILYKEGHIQHSQQLDQGME
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ00060, LENG12
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KIR3DX1 Antibody 100ul

Anti-KIR3DX1 Antibody 100ul