MAGEC3,CT7.2,HCA2
  • MAGEC3,CT7.2,HCA2

Anti-MAGEC3 Antibody 100ul

Ref: AN-HPA052067-100ul
Anti-MAGEC3

Información del producto

Polyclonal Antibody against Human MAGEC3, Gene description: melanoma antigen family C, 3, Alternative Gene Names: CT7.2, HCA2, MAGE-C3, Validated applications: IHC, Uniprot ID: Q8TD91, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MAGEC3
Gene Description melanoma antigen family C, 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AGMPPLPQSPPEIPPQGPPKISPQGPPQSPPQSPLDSCSSPLLWTRLDEESSSEE
Immunogen AGMPPLPQSPPEIPPQGPPKISPQGPPQSPPQSPLDSCSSPLLWTRLDEESSSEE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT7.2, HCA2, MAGE-C3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TD91
HTS Code 3002150000
Gene ID 139081
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MAGEC3 Antibody 100ul

Anti-MAGEC3 Antibody 100ul