SWI5,bA395P17.9
  • SWI5,bA395P17.9

Anti-SWI5 Antibody 25ul

Ref: AN-HPA052032-25ul
Anti-SWI5

Información del producto

Polyclonal Antibody against Human SWI5, Gene description: SWI5 recombination repair homolog (yeast), Alternative Gene Names: bA395P17.9, C9orf119, Validated applications: ICC, IHC, Uniprot ID: Q1ZZU3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SWI5
Gene Description SWI5 recombination repair homolog (yeast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence HLDIQKLKEKRDMLDKEISQFVSEGYSVDELEDHITQLHEYNDIKDVGQMLMGKLAVIRGVTTKELYPEFGL
Immunogen HLDIQKLKEKRDMLDKEISQFVSEGYSVDELEDHITQLHEYNDIKDVGQMLMGKLAVIRGVTTKELYPEFGL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA395P17.9, C9orf119
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q1ZZU3
HTS Code 3002150000
Gene ID 375757
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SWI5 Antibody 25ul

Anti-SWI5 Antibody 25ul