LMO7DN,C13orf45
  • LMO7DN,C13orf45

Anti-LMO7DN Antibody 25ul

Ref: AN-HPA052013-25ul
Anti-LMO7DN

Información del producto

Polyclonal Antibody against Human LMO7DN, Gene description: LMO7 downstream neighbor, Alternative Gene Names: C13orf45, Validated applications: IHC, Uniprot ID: F2Z398, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LMO7DN
Gene Description LMO7 downstream neighbor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MTWLDKGVWTQEDENSCSFSESDFPGCRDQINPSIPSIWTAVSGMMISLEVRWWIKGKQGYVISLGHA
Immunogen MTWLDKGVWTQEDENSCSFSESDFPGCRDQINPSIPSIWTAVSGMMISLEVRWWIKGKQGYVISLGHA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C13orf45
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID F2Z398
HTS Code 3002150000
Gene ID 729420
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LMO7DN Antibody 25ul

Anti-LMO7DN Antibody 25ul