SKIV2L,170A,DDX13
  • SKIV2L,170A,DDX13

Anti-SKIV2L Antibody 100ul

Ref: AN-HPA051959-100ul
Anti-SKIV2L

Información del producto

Polyclonal Antibody against Human SKIV2L, Gene description: superkiller viralicidic activity 2-like (S. cerevisiae), Alternative Gene Names: 170A, DDX13, HLP, SKI2W, SKIV2, Validated applications: ICC, IHC, WB, Uniprot ID: Q15477, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SKIV2L
Gene Description superkiller viralicidic activity 2-like (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence LAELTKRLGALEEPDMTGQLVDLPEYYSWGEELTETQHMIQRRIMESVNGLKSLSAGRVVVVKNQEHHNALGVILQVSSNSTSRVFTTLVLCDKPLSQDPQ
Immunogen LAELTKRLGALEEPDMTGQLVDLPEYYSWGEELTETQHMIQRRIMESVNGLKSLSAGRVVVVKNQEHHNALGVILQVSSNSTSRVFTTLVLCDKPLSQDPQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 170A, DDX13, HLP, SKI2W, SKIV2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15477
HTS Code 3002150000
Gene ID 6499
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SKIV2L Antibody 100ul

Anti-SKIV2L Antibody 100ul