SPDYE1,Ringo1,SPDYE
  • SPDYE1,Ringo1,SPDYE

Anti-SPDYE1 Antibody 100ul

Ref: AN-HPA051750-100ul
Anti-SPDYE1

Información del producto

Polyclonal Antibody against Human SPDYE1, Gene description: speedy/RINGO cell cycle regulator family member E1, Alternative Gene Names: Ringo1, SPDYE, WBSCR19, Validated applications: IHC, WB, Uniprot ID: Q8NFV5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SPDYE1
Gene Description speedy/RINGO cell cycle regulator family member E1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence SLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAM
Immunogen SLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Ringo1, SPDYE, WBSCR19
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NFV5
HTS Code 3002150000
Gene ID 285955
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SPDYE1 Antibody 100ul

Anti-SPDYE1 Antibody 100ul