RIC1,bA207C16.1
  • RIC1,bA207C16.1

Anti-RIC1 Antibody 25ul

Ref: AN-HPA051578-25ul
Anti-RIC1

Información del producto

Polyclonal Antibody against Human RIC1, Gene description: RAB6A GEF complex partner 1, Alternative Gene Names: bA207C16.1, KIAA1432, Validated applications: IHC, Uniprot ID: Q4ADV7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RIC1
Gene Description RAB6A GEF complex partner 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence YCATLDGFAVVFNDGKVGFITPVSSRFTAEQLHGVWPQDVVDGTCVAVNNKYRLMAFGCVSGSVQVYTIDNSTGAMLLSHKLELTAKQYPD
Immunogen YCATLDGFAVVFNDGKVGFITPVSSRFTAEQLHGVWPQDVVDGTCVAVNNKYRLMAFGCVSGSVQVYTIDNSTGAMLLSHKLELTAKQYPD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA207C16.1, KIAA1432
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q4ADV7
HTS Code 3002150000
Gene ID 57589
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RIC1 Antibody 25ul

Anti-RIC1 Antibody 25ul