ADAM17,CD156B,cSVP
  • ADAM17,CD156B,cSVP

Anti-ADAM17 Antibody 100ul

Ref: AN-HPA051575-100ul
Anti-ADAM17

Información del producto

Polyclonal Antibody against Human ADAM17, Gene description: ADAM metallopeptidase domain 17, Alternative Gene Names: CD156B, cSVP, TACE, Validated applications: ICC, WB, Uniprot ID: P78536, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ADAM17
Gene Description ADAM metallopeptidase domain 17
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence KSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
Immunogen KSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD156B, cSVP, TACE
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P78536
HTS Code 3002150000
Gene ID 6868
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ADAM17 Antibody 100ul

Anti-ADAM17 Antibody 100ul