SPRY1,hSPRY1
  • SPRY1,hSPRY1

Anti-SPRY1 Antibody 100ul

Ref: AN-HPA051369-100ul
Anti-SPRY1

Información del producto

Polyclonal Antibody against Human SPRY1, Gene description: sprouty homolog 1, antagonist of FGF signaling (Drosophila), Alternative Gene Names: hSPRY1, Validated applications: IHC, Uniprot ID: O43609, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SPRY1
Gene Description sprouty homolog 1, antagonist of FGF signaling (Drosophila)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PRTAPRQEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSPP
Immunogen PRTAPRQEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSPP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hSPRY1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43609
HTS Code 3002150000
Gene ID 10252
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SPRY1 Antibody 100ul

Anti-SPRY1 Antibody 100ul