DGKZ,DAGK5,DAGK6
  • DGKZ,DAGK5,DAGK6

Anti-DGKZ Antibody 25ul

Ref: AN-HPA051336-25ul
Anti-DGKZ

Información del producto

Polyclonal Antibody against Human DGKZ, Gene description: diacylglycerol kinase, zeta, Alternative Gene Names: DAGK5, DAGK6, DGK-ZETA, hDGKzeta, Validated applications: ICC, IHC, WB, Uniprot ID: Q13574, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DGKZ
Gene Description diacylglycerol kinase, zeta
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence EHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQE
Immunogen EHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DAGK5, DAGK6, DGK-ZETA, hDGKzeta
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13574
HTS Code 3002150000
Gene ID 8525
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DGKZ Antibody 25ul

Anti-DGKZ Antibody 25ul